PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00022268-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 374aa    MW: 42288.9 Da    PI: 7.9567
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00022268-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093023362155
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            k +yps++++  LA+++gL+++q+ +WF N+R ++
  SMil_00022268-RA_Salv 302 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 336
                            569*****************************885 PP

2ELK41.13.8e-14256277122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELK qLlrKYsgyLgsLkqEF+
  SMil_00022268-RA_Salv 256 ELKGQLLRKYSGYLGSLKQEFM 277
                            9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.8E-18119163IPR005540KNOX1
PfamPF037907.3E-20122159IPR005540KNOX1
SMARTSM012563.6E-24168219IPR005541KNOX2
PfamPF037918.1E-21172218IPR005541KNOX2
PfamPF037896.2E-11256277IPR005539ELK domain
SMARTSM011882.8E-8256277IPR005539ELK domain
PROSITE profilePS5121311.174256276IPR005539ELK domain
PROSITE profilePS5007112.989276339IPR001356Homeobox domain
SuperFamilySSF466892.05E-19278353IPR009057Homeodomain-like
SMARTSM003897.4E-13278343IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-28281341IPR009057Homeodomain-like
CDDcd000863.51E-11288340No hitNo description
PfamPF059206.8E-17296335IPR008422Homeobox KN domain
PROSITE patternPS000270314337IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
YNKREREKQT NPKRRKRISR VYKQNPRAQA GAREMESGGG GGGGSSSNNS CFMAFGENNN  60
GYCPIIMMPP QSDSDAGNTH FLPLPSTDIN RSIMLEDHAK NITTTGYYFM DTTNDAAACS  120
TKAKIMAHPH YHRLLSAYAN CQKIGAPPEV VAKLEEACAA AAAMSRHCTS AFGEDPALDQ  180
FMEAYCEMLT KYEQELSKPF KEAMLFLSRI ECQFKALTLS PSASGACIEA METNGSSEEE  240
VDVNNSFIDP QAEDRELKGQ LLRKYSGYLG SLKQEFMKKR KKGKLPKEAR QQLLDWWSRH  300
YKWPYPSESQ KLALAESTGL DQKQINNWFI NQRKRHWKPS EDMQFVVMDA THPHYYMENV  360
LGNPYPMDIS PALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1271280LKQEFMKKRK
2277281KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086207.10.0PREDICTED: homeobox protein SBH1-like
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ5XLC91e-180Q5XLC9_POPCN; Homeodomain protein ARBORKNOX1
STRINGVIT_10s0116g00190.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor